PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_04243.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 370aa    MW: 41063 Da    PI: 6.7711
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_04243.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box32.22.3e-101356340
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                             +r C+++++k++++fC  ++ +lC++C ++ H+       H++v
  Rsa1.0_04243.1_g00003.1 13 ARACDNCSKKQAHWFCAADDAFLCQSCDTSVHSAnalarrHDRV 56
                             578*****************************657788888876 PP

2CCT66.19.7e-23317360144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea+++RY+eKr++R+F KkirYe+RK++Ae RpR+KGrFvk++
  Rsa1.0_04243.1_g00003.1 317 REASVSRYREKRRKRLFTKKIRYEVRKQYAEIRPRMKGRFVKRS 360
                              9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.3E-101158IPR000315B-box-type zinc finger
PROSITE profilePS5011911.2491158IPR000315B-box-type zinc finger
PfamPF006432.3E-91356IPR000315B-box-type zinc finger
CDDcd000219.44E-111458No hitNo description
PROSITE profilePS5101715.785317359IPR010402CCT domain
PfamPF062033.3E-17317359IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MKSLANAVRA KTARACDNCS KKQAHWFCAA DDAFLCQSCD TSVHSANALA RRHDRVRLKN  60
STSPLQEAAT WHQWFTRKPR TPRGSGGKRN NNSPTFHGLV PEISAEDQTD SSDVEEQLMI  120
CQVPVVDPTV VEPKIKVPMM RSDDQEVDKD NAESCLNGFL PTDMELEDFA ADVETLLGRG  180
LDTEYYTMEE LGLSNTEMFK VKKDNDRDGT TMPFDLNFGF YSQNTYEEDA IKNVESSGEC  240
VEVKEEEQKN VLMLNLDYDL VISTWGGQGL PWTSGGPPDI GITGSPAVSM VGNGGGSHKK  300
RNVGGCLPSS GVGDGGREAS VSRYREKRRK RLFTKKIRYE VRKQYAEIRP RMKGRFVKRS  360
SLAVSAGNSP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1328343RKRLFTKKIRYEVRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009109881.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
SwissprotQ8RWD01e-173COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A0D3BI520.0A0A0D3BI52_BRAOL; Uncharacterized protein
STRINGBra012475.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.11e-174B-box type zinc finger protein with CCT domain